Analytical Data
-
Gene name
GLRX2
- Application
-
Alternative Names
GLRX2;GRX2;Glutaredoxin-2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NS18
-
Expression Region
1-124aa
-
AA Sequence
MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
-
Molecular Weight
41.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLRX2, a member of the glutaredoxin family, plays a crucial role in cellular redox regulation, particularly in mitochondrial function and oxidative stress response. Its primary function involves maintaining the reduced state of thiol groups in proteins, thereby preventing oxidative damage and preserving cellular homeostasis. The importance of GLRX2 has been highlighted in various studies linking its expression and activity to numerous physiological and pathological processes, including apoptosis, proliferation, and inflammation. Researchers have increasingly focused on GLRX2 as a potential biomarker for diseases such as cancer and neurodegenerative disorders, where oxidative stress plays a key role. The recombinant protein of GLRX2 is essential for these studies as it allows for detailed investigation of its biochemical properties and functional roles. Moreover, by expressing GLRX2 in vitro, scientists can better understand its mechanisms of action and explore its therapeutic potential. The development of GLRX2 recombinant protein has enabled researchers to perform high-throughput screenings and functional assays, paving the way for innovative therapeutic strategies that target redox imbalances. These studies not only deepen our understanding of GLRX2’s role in cellular processes but also open avenues for the development of novel interventions aimed at mitigating oxidative stress-related diseases.











