Analytical Data
-
Gene name
HIST1H4G
- Application
-
Alternative Names
HIST1H4G; H4/L; H4FL; Histone H4-like protein type G
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99525
-
Expression Region
1-98aa
-
AA Sequence
MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL
-
Molecular Weight
10.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Histone H4 is a crucial component of the nucleosome, fundamental for DNA packaging and gene regulation in eukaryotic cells. The HIST1H4G gene encodes the histone H4 protein, which is essential for maintaining chromatin structure and function. Research into HIST1H4G recombinant protein has gained significant attention due to its role in epigenetic regulation, DNA repair, and cellular processes such as transcription. Abnormal expression or modifications of histones, including H4, are linked to various diseases, including cancer. The ability to produce recombinant HIST1H4G protein allows scientists to study its structure-function relationships, post-translational modifications, and interactions with other proteins in vitro. Such investigations are critical for understanding the mechanisms of chromatin dynamics and their implications in health and disease. Moreover, the recombinant protein can serve as a useful tool in drug discovery and development, particularly in targeting epigenetic regulators. Overall, the study of HIST1H4G recombinant protein is essential for advancing our knowledge of epigenetics and its influence on cellular functions.
