Analytical Data
-
Gene name
HIST1H3F
- Application
-
Alternative Names
H3 histone family member E pseudogene; H3 histone family; member A; H3/A; H31_HUMAN; H3F3; H3FA; Hist1h3a ; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; HIST3H3; histone 1; H3a ; Histone cluster 1; H3a; Histone H3 3 pseudogene; Histone H3.1; Histone H3/a; Histone H3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68431
-
Expression Region
1-136aa
-
AA Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
41.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H3F is a gene that encodes a variant of histone H3, a fundamental protein involved in the packaging of DNA into chromatin, thus playing a crucial role in gene regulation and chromatin structure. The study of HIST1H3F has gained interest in recent years due to its potential implications in various biological processes, including development, cellular differentiation, and the epigenetic regulation of gene expression. Abnormalities in histone modifications and the deregulation of histone genes have been associated with numerous diseases, particularly cancer. Recombination and expression of HIST1H3F provide a valuable model to investigate how specific histone variants influence chromatin dynamics and gene expression patterns. Furthermore, recombinant HIST1H3F proteins allow researchers to perform biochemical assays and structural studies to better understand the interactions between histones and DNA, as well as the impact of post-translational modifications on chromatin architecture. Research into HIST1H3F and its recombinant forms not only elucidates fundamental biological mechanisms but may also open new avenues for therapeutic interventions in diseases linked to epigenetic dysregulation. The implications extend from basic science to clinical applications, contributing to our understanding of how histone variants impact cellular function and the potential for targeted therapies in oncology, making it a significant focus within the field of molecular biology and genetics.
