Analytical Data
-
Gene name
FBXO48
- Application
-
Alternative Names
FBXO48;FBX9;VCIA1;F-box only Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5FWF7
-
Expression Region
1-155aa
-
AA Sequence
MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER
-
Molecular Weight
25.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXO48 is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome system, a key regulatory pathway for protein degradation and turnover in cells. These proteins act as scaffolds for the assembly of E3 ubiquitin ligase complexes, facilitating the transfer of ubiquitin to substrate proteins, which often marks them for degradation. The research into FBXO48 has gained attention due to its potential involvement in various cellular processes, including cell cycle regulation, signal transduction, and response to stressors. Emerging studies suggest that aberrations in the expression or function of FBXO48 may be linked to several diseases, including cancer and neurodegenerative disorders. Understanding the mechanisms by which FBXO48 regulates protein degradation and its interactions with other cellular components could offer insights into its role in disease progression and open avenues for novel therapeutic strategies. Additionally, recombinant FBXO48 protein studies allow for a detailed characterization of its functional properties, substrate specificity, and potential pathways it influences, which is invaluable for both basic and applied research in cellular biology and disease modulation.











