Analytical Data
-
Gene name
HIST1H2BC
- Application
-
Alternative Names
H2BC4; H2BFL; HIST1H2BC;; H2BC6; H2BFH; HIST1H2BE;; H2BC7; H2BFG; HIST1H2BF;; H2BC8; H2BFA; HIST1H2BG;; H2BC10; H2BFK; HIST1H2BIHistone H2B type 1-C/E/F/G/I; Histone H2B.1 A; Histone H2B.a; H2B/a; Histone H2B.g; H2B/g; Histone H2B.h; H2B/h; Histone H2B.k; H2B/k; Histone H2B.l; H2B/l
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62807
-
Expression Region
1-126aa
-
AA Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Molecular Weight
39.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H2BC is a member of the histone H2B family, specifically part of the core histone complex that plays a crucial role in the structuring of DNA into chromatin. This protein is vital for the regulation of gene expression and is involved in several cellular processes including DNA replication, repair, and transcriptional regulation. Recent studies have highlighted the significance of HIST1H2BC in various physiological and pathological contexts, such as its overexpression in certain cancers, which can lead to altered chromatin dynamics and gene misregulation. Understanding the function and mechanisms of HIST1H2BC is essential for comprehending its potential role in disease development, particularly in tumorigenesis. Moreover, the exploration of HIST1H2BC through recombinant protein techniques has provided insights into its structural properties and interactions with other chromatin-associated proteins. This research is pivotal for developing targeted therapies aimed at modulating histone function to achieve better outcomes in cancer treatment. The study of HIST1H2BC, therefore, not only enhances our understanding of chromatin biology but also presents valuable opportunities for therapeutic interventions in diseases characterized by dysregulated gene expression.
