Cat: PA2000-8254

Recombinant Human HIST1H2BC Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HIST1H2BC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    H2BC4; H2BFL; HIST1H2BC;; H2BC6; H2BFH; HIST1H2BE;; H2BC7; H2BFG; HIST1H2BF;; H2BC8; H2BFA; HIST1H2BG;; H2BC10; H2BFK; HIST1H2BIHistone H2B type 1-C/E/F/G/I; Histone H2B.1 A; Histone H2B.a; H2B/a; Histone H2B.g; H2B/g; Histone H2B.h; H2B/h; Histone H2B.k; H2B/k; Histone H2B.l; H2B/l

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62807

  • Expression Region

    1-126aa

  • AA Sequence

    MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

  • Molecular Weight

    39.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HIST1H2BC is a member of the histone H2B family, specifically part of the core histone complex that plays a crucial role in the structuring of DNA into chromatin. This protein is vital for the regulation of gene expression and is involved in several cellular processes including DNA replication, repair, and transcriptional regulation. Recent studies have highlighted the significance of HIST1H2BC in various physiological and pathological contexts, such as its overexpression in certain cancers, which can lead to altered chromatin dynamics and gene misregulation. Understanding the function and mechanisms of HIST1H2BC is essential for comprehending its potential role in disease development, particularly in tumorigenesis. Moreover, the exploration of HIST1H2BC through recombinant protein techniques has provided insights into its structural properties and interactions with other chromatin-associated proteins. This research is pivotal for developing targeted therapies aimed at modulating histone function to achieve better outcomes in cancer treatment. The study of HIST1H2BC, therefore, not only enhances our understanding of chromatin biology but also presents valuable opportunities for therapeutic interventions in diseases characterized by dysregulated gene expression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US