Cat: PA1000-1258

Recombinant E.coli glsA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    glsA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    glsA1;ybaS;Glutaminase 1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P77454

  • Expression Region

    1-310aa

  • AA Sequence

    MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDG NVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNS VIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQ VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLL NTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDW AYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA KQLGYNVFKG

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The GLSA1 gene encodes a protein of significant interest due to its role in various biological processes, including stress response and cellular signaling pathways. Recent research has highlighted its potential involvement in metabolic regulation and its implications in diseases such as cancer and neurodegenerative disorders. As scientists aim to unravel the precise functions of GLSA1, recombinant protein studies have become essential for understanding the protein's structure-function relationship. By expressing and purifying the GLSA1 recombinant protein in a suitable host, researchers can analyze its biochemical properties, interactions with other molecules, and response to different stimuli. Additionally, these studies facilitate the development of antibodies and inhibitors that target GLSA1, providing valuable insights into therapeutic strategies. The exploration of GLSA1 through recombinant technology not only expands our knowledge about its biological significance but also potentially uncovers new avenues for treatment in pathologies associated with its dysregulation. Overall, the research on GLSA1 recombinant protein is pivotal for advancing the understanding of its mechanisms and biological roles, ultimately contributing to novel therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US