Analytical Data
-
Gene name
RNF5
- Application
-
Alternative Names
RNF5；G16；NG2；RMA1；E3 ubiquitin-Protein ligase RNF5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99942
-
Expression Region
2-180aa
-
AA Sequence
AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
-
Molecular Weight
25.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF5, an E3 ubiquitin ligase, plays a crucial role in regulating various cellular processes by mediating proteasomal degradation of target proteins, thereby influencing cell signaling, immune responses, and stress responses. Research on RNF5 has gained momentum due to its implications in several diseases, including cancer, autoimmune disorders, and neurodegenerative diseases. The ability of RNF5 to modulate the stability and activity of key regulatory proteins makes it a valuable target for therapeutic intervention. Moreover, RNF5's involvement in the endoplasmic reticulum (ER) stress response highlights its importance in maintaining cellular homeostasis. Recent studies have demonstrated that RNF5 participates in the regulation of protein quality control mechanisms, further underlining its significance in disease contexts. Recombinant RNF5 proteins are essential for in-depth studies aimed at elucidating its biological functions, understanding its role in various signaling pathways, and exploring its potential as a biomarker or therapeutic target. By generating recombinant RNF5, researchers can investigate its interactions with substrate proteins and other cellular factors, providing insights into the molecular mechanisms by which it exerts its effects. Overall, the exploration of RNF5 and its functions through recombinant protein studies represents a promising avenue for advancing our knowledge of cellular regulation and developing novel therapeutic strategies for related diseases.
