Analytical Data
-
Gene name
GIP
- Application
-
Alternative Names
GIP;Gastric inhibitory polypeptide
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09681
-
Expression Region
22-153aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSEKKEGHFSALPSLPVGSHAKVSSPQPR GPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARA LELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLC RLRSR
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GIP (Gastric Inhibitory Polypeptide) is an important incretin hormone produced by K cells in the duodenum that plays a crucial role in glucose metabolism and insulin regulation. Its primary function is to stimulate insulin secretion in response to food intake, thereby facilitating glucose homeostasis. Research on GIP has gained significant interest due to its potential implications in obesity and type 2 diabetes management. Abnormal GIP signaling has been associated with insulin resistance and impaired glucose tolerance, making it a target for therapeutic interventions. Recent studies have focused on the development of GIP analogs and recombinant proteins to enhance its beneficial effects or inhibit its activity in pathological conditions. These GIP-based therapeutics are being explored for their capability to improve metabolic outcomes, offering a promising avenue for treating metabolic diseases. Additionally, GIP receptor agonists and antagonists are under investigation for their roles in appetite regulation and body weight control. Overall, the study of GIP and its recombinant forms represents a dynamic field that bridges endocrinology, metabolic research, and therapeutic innovation, aiming to combat global health challenges posed by metabolic disorders.











