Cat: PA2000-4086

Recombinant Human DIT33 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DIT33

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DIT33;Pepsin inhibitor Dit33

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q27384

  • Expression Region

    18-234aa

  • AA Sequence

    SVINRHNKRFAGFSVAGIGGTAGCVVVDNKLFANSFYLRDLTTEEQRELAQYVEDSNQYKEEVKTSLEERRKGWQLARHGEKDAKVLSSLAEKKFPKPPKKPSFCSAGDTTQYYFDGCMVQNNKIYVGRMYVRDLTSDEINQLKTFDAKMTAYQKYLSSSIQQQVDSLFGDKSNLFNLFTDTRHETSSQPSDATTISTTTQAPVEPPETPHFCIAIY

  • Molecular Weight

    32.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The DIT33 protein is a member of the DIT (Dipeptidyl Aminopeptidase) family, which has garnered interest due to its potential roles in various biological processes, including cell signaling, metabolism, and immune response. Research on DIT33 has revealed its involvement in critical cellular functions, suggesting that it may contribute to the regulation of protein turnover and the maintenance of cell homeostasis. Understanding the structure and function of DIT33 can provide insights into its mechanisms of action and its interplay with other cellular pathways. Additionally, dysregulation of DIT33 has been implicated in several diseases, making it a promising target for therapeutic intervention. Recent advances in protein engineering techniques have facilitated the generation of recombinant DIT33 proteins, allowing for in-depth studies of their enzymatic activities and interactions with other biomolecules. Investigating the biochemical characteristics and biological activities of DIT33 can enhance our understanding of its role in health and disease and pave the way for the development of novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US