Analytical Data
-
Gene name
DIT33
- Application
-
Alternative Names
DIT33；Pepsin inhibitor Dit33
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q27384
-
Expression Region
18-234aa
-
AA Sequence
SVINRHNKRFAGFSVAGIGGTAGCVVVDNKLFANSFYLRDLTTEEQRELAQYVEDSNQYKEEVKTSLEERRKGWQLARHGEKDAKVLSSLAEKKFPKPPKKPSFCSAGDTTQYYFDGCMVQNNKIYVGRMYVRDLTSDEINQLKTFDAKMTAYQKYLSSSIQQQVDSLFGDKSNLFNLFTDTRHETSSQPSDATTISTTTQAPVEPPETPHFCIAIY
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DIT33 protein is a member of the DIT (Dipeptidyl Aminopeptidase) family, which has garnered interest due to its potential roles in various biological processes, including cell signaling, metabolism, and immune response. Research on DIT33 has revealed its involvement in critical cellular functions, suggesting that it may contribute to the regulation of protein turnover and the maintenance of cell homeostasis. Understanding the structure and function of DIT33 can provide insights into its mechanisms of action and its interplay with other cellular pathways. Additionally, dysregulation of DIT33 has been implicated in several diseases, making it a promising target for therapeutic intervention. Recent advances in protein engineering techniques have facilitated the generation of recombinant DIT33 proteins, allowing for in-depth studies of their enzymatic activities and interactions with other biomolecules. Investigating the biochemical characteristics and biological activities of DIT33 can enhance our understanding of its role in health and disease and pave the way for the development of novel therapeutic strategies.
