Analytical Data
-
Gene name
GINS4
- Application
-
Alternative Names
GINS4;SLD5;DNA replication complex GINS Protein SLD5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRT9
-
Expression Region
1-223aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTEEVDFLGQDSDGGSEEVVLTPAELIERL EQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQM EMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFA REFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GINS4 (Go-Ichi-Ni-San 4) is a critical component of the GINS complex, which plays a pivotal role in the process of DNA replication in eukaryotic cells. This protein functions as part of a multi-subunit complex that is essential for the unwinding of DNA and the initiation of the replication fork. Recent studies have highlighted the importance of GINS4 in maintaining genomic stability, as any dysfunction in its activity can lead to errors during DNA replication, resulting in mutations and potential oncogenesis. Researchers have been increasingly focused on the structural and functional characterization of GINS4, particularly in understanding its interactions with other replication machinery components, such as MCM (mini-chromosome maintenance) proteins and DNA polymerases. Advances in recombinant protein technology have enabled the production of GINS4 in vitro, providing valuable insights into its biochemical properties and its role in the replication process. This research not only contributes to our fundamental understanding of DNA replication but also has implications for cancer biology, as targeting the GINS complex could offer novel therapeutic strategies for cancers characterized by replication stress. Overall, the study of GINS4 and its associated pathways represents a significant avenue for both basic and applied biological research, with the potential to unravel the complexities of cellular replication and stand as a foundation for developing future cancer therapies.











