Analytical Data
-
Gene name
HHAT
- Application
-
Alternative Names
AC115917.1; AI462858; FLJ10724; FLJ34867; Hedgehog acyltransferase; Hhat; HHAT_HUMAN; MART 2; MART-2; MART2; Melanoma antigen recognized by T cells 2; Melanoma antigen recognized by T-cells 2; MGC11697; OTTMUSP00000033669; Protein cysteine N palmitoyltransferase HHAT; Protein-cysteine N-palmitoyltransferase HHAT; RGD1311746; SKI1; Skinny hedgehog protein 1; Skinny hedgehog protein; Skn
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VTY9
-
Expression Region
1-493aa
-
AA Sequence
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKYLVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFSPQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTYATD
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HHAT (Hedgehog Acyltransferase) is a crucial enzyme involved in the post-translational modification of Hedgehog (Hh) signaling proteins, which play a significant role in developmental processes and tissue homeostasis. Aberrant Hedgehog signaling is implicated in various diseases, including cancers and congenital disorders. Understanding HHAT's function and mechanisms is essential for elucidating the pathways involved in these conditions. Recent research has focused on characterizing the structure and activity of HHAT, as it catalyzes the addition of lipid modifications to Hh proteins, enhancing their stability and activity. Studies involving HHAT recombinant proteins have unveiled key insights into the enzyme's role in lipidation, which is pivotal for Hh signaling's initiation and propagation. By employing techniques such as X-ray crystallography and biochemical assays, researchers aim to develop HHAT inhibitors that could serve as potential therapeutic agents for Hh-related diseases. The exploration of HHAT and its impact on Hedgehog signaling is a burgeoning area of research, offering promising avenues for drug discovery and the development of targeted therapies.
