Analytical Data
-
Gene name
HHLA2
- Application
-
Alternative Names
Human endogenous retrovirus-H long terminal repeat-associating protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UM44
-
Expression Region
23-344aa
-
AA Sequence
IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHN
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HHLA2 (Human Histocompatibility Leukocyte Antigen 2) is a member of the Immunoglobulin Superfamily and plays a significant role in immune regulation. It is predominantly expressed on the surface of immune cells, particularly in the context of cancer and inflammation. Research has indicated that HHLA2 can act as a co-inhibitory molecule, influencing T cell activation and function, which can be crucial in the development of tumor evasion mechanisms. Studies show that elevated HHLA2 levels correlate with poor prognosis in various cancers, suggesting its potential as a biomarker and therapeutic target. The recombinant expression of HHLA2 proteins enables the exploration of its biological functions and interactions with immune receptors, such as PD-1 and CTLA-4, thereby providing insights into its role in immune modulation. This research has important implications for developing immunotherapies that harness the body's immune system to combat cancer and improve patient outcomes. Understanding the structural properties and functional mechanisms of HHLA2 can further facilitate the design of targeted treatments that enhance anti-tumor immune responses while minimizing adverse effects, ultimately contributing to more effective cancer therapies.
