Analytical Data
-
Gene name
ATXN7
- Application
-
Alternative Names
ATXN7；SCA7；Ataxin-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15265
-
Expression Region
79-401aa
-
AA Sequence
GERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCPAHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRH
-
Molecular Weight
39.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATXN7, or Ataxin-7, is a protein encoded by the ATXN7 gene, which is part of the polyglutamine (polyQ) expansion family associated with several neurodegenerative diseases, particularly spinocerebellar ataxia type 7 (SCA7). This condition is characterized by motor dysfunction, vision problems, and progressive neurological decline. The research on ATXN7 recombinant protein has gained prominence in the field of molecular biology due to its implications in understanding the pathogenesis of polyQ disorders. ATXN7 is known to interact with various cellular proteins and play a significant role in transcriptional regulation, and the presence of an extended polyQ tract in patients leads to the misfolding and aggregation of this protein, contributing to neurotoxicity. Studies involving recombinant ATXN7 focus on elucidating the structure-function relationship of the protein, its aggregation pathway, and the cellular mechanisms underlying SCA7. Furthermore, the recombinant form of ATXN7 serves as a vital tool for investigating potential therapeutic strategies aimed at mitigating the disease's symptoms. Understanding ATXN7's functional dynamics and its pathological variants could pave the way for the development of targeted interventions and provide insights into broader neurodegenerative processes linked to polyglutamine expansions. As such, the study of ATXN7 not only enhances our comprehension of SCA7 but also contributes to the overarching goal of developing effective treatments for polyQ-related disorders.
