Analytical Data
-
Gene name
MIP1b
- Application
-
Alternative Names
MIP1b；LAG1；MIP1B；SCYA4；C-C motif chemokine 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13236
-
Expression Region
24-92aa
-
AA Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQV CADPSESWVQEYVYDLELN
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MIP1b (Macrophage Inflammatory Protein 1 beta) is a chemokine that plays a crucial role in the immune response, particularly in the recruitment and activation of immune cells such as macrophages and T cells. Understanding the functions and mechanisms of MIP1b is significant for developing therapeutic approaches to various inflammatory diseases, autoimmune disorders, and cancer. Recent studies have revealed that MIP1b not only participates in normal immune regulation but also influences the progression of diseases by modulating inflammatory responses. Researchers are interested in producing recombinant MIP1b proteins to study its biological activities and interactions with receptors. These proteins can facilitate the exploration of how MIP1b functions in both physiological and pathological conditions, enabling the identification of potential therapeutic targets. Additionally, the recombinant MIP1b can be utilized in the development of vaccines and immunotherapies, offering hope for improved treatments for conditions characterized by dysregulated immune responses. The exploration of MIP1b’s role in chronic inflammation and tumor microenvironments may provide insights into novel strategies aimed at harnessing the immune system to combat diseases. Overall, the research on recombinant MIP1b proteins holds promise for advancing our understanding of immune mechanisms and developing innovative therapeutic approaches.
