Analytical Data
-
Gene name
HELT
- Application
-
Alternative Names
HELT; Hairy and enhancer of split-related protein HELT; HES/HEY-like transcription factor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NFD8
-
Expression Region
1-327aa
-
AA Sequence
MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HELT, or hematopoietic and lymphoid tissue protein, is a notable protein involved in various biological processes, particularly within the immune system. The study of HELT-recombinant proteins has gained momentum due to its potential implications in understanding hematopoiesis, lymphocyte development, and immune responses. Previous research has highlighted HELT’s role in regulating gene expression and its interaction with other transcription factors, which are crucial for normal immune function and the differentiation of hematopoietic cells. Moreover, abnormalities in HELT expression have been linked to certain hematological disorders, thus emphasizing the importance of understanding its molecular mechanisms. The generation of HELT-recombinant proteins allows for detailed biochemical characterization and functional studies, enabling researchers to dissect its role in cellular signaling pathways and its potential as a therapeutic target. Continued investigation into HELT could provide insights into novel approaches for treating immune-related diseases and improving our understanding of the fundamental processes governing blood cell formation and immunity. With advancements in protein engineering and production technologies, the availability of HELT-recombinant proteins can significantly enhance experimental approaches in both basic and applied biomedical research, paving the way for innovative strategies in immunotherapy and regenerative medicine.
