Analytical Data
-
Gene name
GCG
- Application
-
Alternative Names
GCG；BOTCH;Glutathione-specific gamma-glutamylcyclotransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01275
-
Expression Region
53-89aa
-
AA Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
-
Molecular Weight
6.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GCG (glucagon) recombinant proteins has gained significant attention due to their crucial role in glucose metabolism and potential therapeutic applications in diabetes management. Glucagon, a peptide hormone produced by the alpha cells of the pancreas, is essential for elevating blood glucose levels during hypoglycemic episodes. Advances in biotechnology have enabled the production of recombinant GCG proteins, which facilitate the study of its structure-function relationship, receptor interactions, and metabolic effects. The ability to generate high-purity GCG proteins is vital for both basic research and the development of novel glucose-regulating therapies. Understanding the mechanisms by which GCG influences insulin secretion and hepatic glucose production can lead to innovative strategies for treating metabolic disorders. Furthermore, recombinant GCG proteins offer opportunities for the design of biosimilars, potentially improving patient outcomes and access to therapies. As research progresses, insights gained from GCG recombinant proteins may revolutionize our approach to diabetes treatment and advance personalized medicine.
