Analytical Data
-
Gene name
C8A
- Application
-
Alternative Names
C8A；ATPIC；FIC1；PFIC；Phospholipid-transporting ATPase IC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07357
-
Expression Region
31-584aa
-
AA Sequence
AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
-
Molecular Weight
65.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The C8A recombinant protein is derived from the C8A gene, which encodes a component of the complement system, specifically the complement protein C8. This protein plays a crucial role in the immune response by facilitating the formation of the membrane attack complex (MAC), which is vital for lysing pathogens and infected cells. Research on C8A recombinant protein has gained significance due to its potential therapeutic applications, particularly in treating diseases where complement pathways are dysregulated. Understanding C8A's structure and function can lead to novel strategies for modulating the immune response in conditions such as autoimmune disorders, cancers, and infectious diseases. Furthermore, advancements in recombinant DNA technology have enabled the production of this protein in various expression systems, allowing for detailed studies of its biological activity, interaction with other complement components, and its role in inflammation. Investigating the C8A protein also sheds light on evolutionary aspects of the complement system, as it shares homology with similar proteins across different species. As research progresses, the ability to engineer C8A and its derivatives may open new avenues for targeted therapies that harness the body's immune system more effectively. Overall, the study of C8A recombinant protein is poised at the intersection of immunology, molecular biology, and therapeutic development, underscoring its promise as a focal point for ongoing and future research in complement biology.
