Analytical Data
-
Gene name
EPCR
- Application
-
Alternative Names
EPCR；EPCR；Endothelial Protein C receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNN8
-
Expression Region
18-210aa
-
AA Sequence
SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTI IQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLG CELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQ LNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSVDHHHHH H
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of Epends in Protein C Receptor (EPCR) recombinant proteins has gained significant interest due to their crucial role in the regulation of coagulation and inflammation. EPCR, a membrane protein expressed on endothelial cells, binds to activated protein C and plays a key part in the protein C pathway, which is essential for maintaining hemostatic balance and protecting against thrombosis. Understanding the structure and function of EPCR is critical for developing therapeutic strategies for various thrombotic disorders and inflammatory diseases. Additionally, EPCR has been implicated in modulating immune responses and endothelial cell function, making it a potential target for novel treatments. The production of recombinant EPCR proteins allows for in-depth studies of its interactions and effects in vitro and in vivo. This research provides insights into its mechanisms of action, the role of EPCR in diseases, and potential implications in clinical applications, such as gene therapy or drug development. Overall, the exploration of EPCR recombinant proteins not only enhances our understanding of coagulation but also opens new avenues for therapeutic interventions in related pathological conditions.
