Analytical Data
-
Gene name
GCET2
- Application
-
Alternative Names
GCET2；GAL；GCET2;Germinal center-associated signaling and motility Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6F7
-
Expression Region
1-178aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGNSLLRENRRQQNTQEMPWNVRMQSP KQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVD QTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETE YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH L
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GCET2, or Germinal Center Transcript 2, is a gene that has garnered significant attention in recent years due to its potential role in the immune system and its implications in various diseases, particularly in the context of B cell development and function. It is predominantly expressed in germinal centers of lymphoid tissues, where B cells mature and undergo processes like somatic hypermutation and class switching. Research has indicated that GCET2 may play a crucial role in regulating these processes, influencing the affinity maturation of antibodies and contributing to the generation of long-lived plasma cells. Additionally, aberrations in GCET2 expression have been linked to autoimmune diseases and certain types of cancers, particularly lymphomas. Therefore, understanding the molecular pathways in which GCET2 is involved could offer insights into novel therapeutic targets for these conditions. Studies involving recombinant GCET2 proteins aim to elucidate its functional role and interactions with other immune components, paving the way for innovative approaches in immunotherapy and disease management. This interest is further fueled by advancements in protein engineering techniques, allowing for the production of highly pure and active recombinant proteins for detailed structural and functional analyses. Overall, the investigation of GCET2 and its recombinant forms is pivotal in advancing our understanding of immunological processes and could significantly impact therapeutic strategies for immune-related disorders.
