Cat: PA2000-8201

Recombinant Human HCNGP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HCNGP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Transcriptional regulator protein HCNGP

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHR5

  • Expression Region

    91-308aa

  • AA Sequence

    TEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

  • Molecular Weight

    28.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HCNGP, or Heterologous Co-Expression of Non-Glycosylated Proteins, has gained significant attention in the field of biotechnology and biopharmaceuticals due to its potential to improve the production of recombinant proteins. Traditional expression systems often struggle with the post-translational modifications that glycoproteins require for proper functionality. HCNGP focuses on expressing proteins in a non-glycosylated form, facilitating easier purification and characterization while ensuring that important structural features are retained. This approach is particularly valuable for the development of vaccines and therapeutic proteins, as it minimizes the risk of undesired immune responses associated with glycosylation variations. Researchers have been exploring various expression systems, including bacterial, yeast, and microbial platforms, to optimize the yield and functionality of HCNGP. The strategy helps to bypass complexities typically presented in mammalian systems, allowing for faster and more cost-effective production processes. As the demand for biopharmaceuticals grows, the HCNGP approach offers promising pathways for addressing the challenges associated with the effective production of therapeutic proteins, ultimately benefiting both research and clinical applications. This emerging technology paves the way for innovative solutions in the production of safe and effective biopharmaceuticals, enhancing their availability and accessibility in the healthcare sector.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US