Cat: PA2000-8200

Recombinant Human HCN4 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HCN4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HCN4Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3Q4

  • Expression Region

    1105-1203aa

  • AA Sequence

    SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL

  • Molecular Weight

    36.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of HCN4 (Hyperpolarization-activated cyclic nucleotide-gated channel 4) recombinant protein has gained significant attention due to its crucial role in cardiac physiology and neuronal function. HCN4 is a member of the HCN channel family, which is pivotal in generating the pacemaker potential in the sinoatrial node of the heart and is involved in various neuronal activities. Its unique biophysical properties, including sensitivity to membrane voltage and modulation by cyclic nucleotides, make HCN4 a key player in regulating heart rate and neuronal excitability. Understanding the structure and function of HCN4 at the molecular level through recombinant protein studies can provide insights into its mechanism of action, the pharmacological modulation of its activity, and its implications in heart rhythm disorders and neurological conditions. Additionally, the exploration of HCN4 as a therapeutic target for arrhythmias and other cardiac diseases underscores the importance of this research area. Generating recombinant HCN4 proteins allows researchers to conduct functional assays, screen for specific inhibitors, and investigate the protein's interactions with other cellular components, paving the way for novel treatment strategies and deepening our understanding of cardiac and neural electrophysiology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US