Analytical Data
-
Gene name
HCN4
- Application
-
Alternative Names
HCN4Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3Q4
-
Expression Region
1105-1203aa
-
AA Sequence
SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of HCN4 (Hyperpolarization-activated cyclic nucleotide-gated channel 4) recombinant protein has gained significant attention due to its crucial role in cardiac physiology and neuronal function. HCN4 is a member of the HCN channel family, which is pivotal in generating the pacemaker potential in the sinoatrial node of the heart and is involved in various neuronal activities. Its unique biophysical properties, including sensitivity to membrane voltage and modulation by cyclic nucleotides, make HCN4 a key player in regulating heart rate and neuronal excitability. Understanding the structure and function of HCN4 at the molecular level through recombinant protein studies can provide insights into its mechanism of action, the pharmacological modulation of its activity, and its implications in heart rhythm disorders and neurological conditions. Additionally, the exploration of HCN4 as a therapeutic target for arrhythmias and other cardiac diseases underscores the importance of this research area. Generating recombinant HCN4 proteins allows researchers to conduct functional assays, screen for specific inhibitors, and investigate the protein's interactions with other cellular components, paving the way for novel treatment strategies and deepening our understanding of cardiac and neural electrophysiology.
