Analytical Data
-
Gene name
GPR154
- Application
-
Alternative Names
NPSR1; GPR154; GPRA; PGR14; Neuropeptide S receptor; G-protein coupled receptor 154; G-protein coupled receptor PGR14; G-protein coupled receptor for asthma susceptibility
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6W5P4
-
Expression Region
2-53aa
-
AA Sequence
PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
-
Molecular Weight
31.46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR154, also known as the orphan G protein-coupled receptor 154, has garnered significant interest in recent years due to its potential roles in various physiological and pathological processes. This receptor is predominantly expressed in the brain and some peripheral tissues, suggesting its involvement in neurodevelopment and neurological disorders. Emerging studies indicate that GPR154 may play a crucial role in neurotransmission, making it a candidate for research related to mood regulation and psychosomatic disorders. Furthermore, its function in the immune system highlights its possible involvement in inflammation and autoimmune diseases. Despite its implications in these areas, the exact ligand and downstream signaling pathways of GPR154 remain largely unexplored, necessitating the production of recombinant GPR154 protein for further study. Investigating this recombinant protein will enable researchers to elucidate the receptor's structure, function, and interactions with potential ligands, thereby advancing our understanding of its biological significance. Overall, the characterization of GPR154 and its associated pathways could reveal new therapeutic targets for treating neurological and immune-related conditions.
