Cat: PA2000-3857

Recombinant Human GDF2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GDF2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GDF2;BMP9;Growth/differentiation factor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UK05

  • Expression Region

    300-429aa

  • AA Sequence

    HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

  • Molecular Weight

    22.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GDF2 (Growth Differentiation Factor 2), a member of the transforming growth factor-beta (TGF-β) superfamily, plays a crucial role in various biological processes, including embryonic development, tissue regeneration, and the modulation of inflammation. Its involvement in cardiovascular diseases and cellular differentiation has garnered significant interest, particularly due to its potential therapeutic applications. The recombinant GDF2 protein has been a focus of research aimed at exploring its signaling pathways and biological functions in detail. Studies have illustrated that GDF2 can influence endothelial cell function, enhance angiogenesis, and promote vascular homeostasis. Understanding the mechanisms by which GDF2 operates is vital, as its dysregulation could contribute to pathological conditions such as heart failure and pulmonary hypertension. Furthermore, the production of recombinant GDF2 provides a platform for investigating its interactions with other molecular players in the TGF-β signaling cascade, thereby opening avenues for developing targeted therapies. As such, the study of recombinant GDF2 not only contributes to the fundamental knowledge of growth factor biology but also has implications for innovative treatment strategies in regenerative medicine and cardiovascular health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US