Analytical Data
-
Gene name
Tsc22d4
- Application
-
Alternative Names
Tsc22d4；THG1；THG1-PIT；TSC22 domain family Protein 4
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9EQN3
-
Expression Region
1-387aa
-
AA Sequence
MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI
-
Molecular Weight
42.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSC22D4, a member of the TSC22 domain family of proteins, is thought to play a significant role in cellular processes such as differentiation and stress responses. Its expression has been linked to various physiological and pathological conditions, including immune responses, inflammation, and tumorigenesis. Recent studies have indicated that TSC22D4 may act as a transcriptional regulator, influencing the expression of genes involved in these processes. The recombinant protein form of TSC22D4 has become a key research tool, enabling scientists to investigate its function more thoroughly and understand its mechanisms of action in cellular contexts. By producing TSC22D4 as a recombinant protein, researchers can study its biochemical properties, interactions with other biomolecules, and its role in signaling pathways. This study enhances our understanding of TSC22D4's role in health and disease, potentially leading to new therapeutic targets for diseases associated with dysregulated TSC22D4 expression, including cancer and autoimmune disorders. Overall, research on TSC22D4 recombinant protein not only illuminates the functional aspects of this protein but also paves the way for its application in clinical settings.
