Cat: PA1000-9679

Recombinant Human MMP23A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP23A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP23A;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75900

  • Expression Region

    1-390aa

  • AA Sequence

    MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSA AQGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSF PRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHT DCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGV WLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLH RLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATT PPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA LGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG

  • Molecular Weight

    43.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MMP23A, a member of the matrix metalloproteinase (MMP) family, plays a crucial role in the remodeling of extracellular matrix components and is implicated in various physiological processes, including embryogenesis, wound healing, and tissue repair. Research has increasingly focused on MMP23A due to its potential involvement in pathological conditions such as cancer metastasis, fibrosis, and inflammatory diseases. Understanding the functionality of MMP23A is essential, as its dysregulation can lead to enhanced tissue degradation and contribute to disease progression. Recombinant MMP23A protein has been produced to facilitate in-depth studies of its enzymatic activity, substrate specificity, and regulatory mechanisms. These studies typically employ techniques such as zymography and enzyme assays to analyze its functional properties. Moreover, the development of MMP23A inhibitors may provide novel therapeutic strategies for diseases characterized by excessive matrix degradation. Consequently, research on recombinant MMP23A not only furthers our understanding of its biological roles but also holds promise for developing targeted therapies that could ameliorate diseases associated with MMP dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US