Analytical Data
-
Gene name
GPR143
- Application
-
Alternative Names
GPR143; OA1; G-protein coupled receptor 143; Ocular albinism type 1 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51810
-
Expression Region
1-424aa
-
AA Sequence
MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
-
Molecular Weight
72.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR143, also known as the opaque gene or the eye color gene, is a member of the G protein-coupled receptor (GPCR) family and plays a crucial role in regulating melanin synthesis in melanocytes. Mutations or alterations in the GPR143 gene are associated with X-linked ocular albinism, a condition characterized by reduced pigmentation in the eyes and skin, as well as vision problems. Given its significant implications in pigmentation disorders and potential therapeutic targets, research on GPR143 recombinant protein has gained momentum. Producing and characterizing this protein facilitates the understanding of its structure-function relationship, signaling pathways, and molecular mechanisms involved in melanogenesis. Furthermore, insights gained from studying GPR143 can aid in the development of novel treatments for pigmentation disorders and enhance our understanding of related diseases, such as melanoma. Additionally, GPR143's unique role in the central nervous system and its expression in other tissues suggest potential pathways linking pigmentation with neurodevelopmental and neurodegenerative disorders. Consequently, investigating GPR143 and its recombinant protein not only contributes to the field of dermatological research but also opens avenues for interdisciplinary studies encompassing genetics, neurology, and therapeutic advancements. The recombinant GPR143 protein serves as a valuable tool for high-throughput screening and drug discovery, making it a focal point of contemporary biomedical research.











