Analytical Data
-
Gene name
GPR141
- Application
-
Alternative Names
GPR141; PGR13; Probable G-protein coupled receptor 141; G-protein coupled receptor PGR13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z602
-
Expression Region
1-305aa
-
AA Sequence
MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR141 is a member of the G protein-coupled receptor (GPCR) family, which plays a crucial role in various physiological processes and has emerged as a significant target in drug discovery. Initially identified through genomic studies, GPR141 has been linked to several critical functions, including regulation of metabolic pathways and signaling in the central nervous system. The exploration of GPR141's structure and function has gained momentum owing to its potential implications in metabolic disorders, psychiatric conditions, and cancer. Despite its importance, limited research has been conducted on the receptor, primarily due to challenges in obtaining sufficient amounts of functional protein for biochemical and biophysical studies. Recombinant protein technology has thus become a vital tool in GPR141 research, enabling the production of large quantities of the receptor for functional assays and structural analysis. This advancement is pivotal for elucidating the receptor's signaling mechanisms, interactions with ligands, and potential therapeutic applications. Understanding GPR141 at the molecular level could lead to the development of novel therapeutic strategies targeting this receptor, possibly resulting in innovative treatments for various diseases. Continued research is essential to uncover the full biological significance of GPR141 and its role in health and disease.
