Analytical Data
-
Gene name
Plaur
- Application
-
Alternative Names
Plaur；MO3；UPAR；Urokinase plasminogen activator surface receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03405
-
Expression Region
1-335aa
-
AA Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Plaur, or Plasminogen Activator, Urokinase Receptor, is a crucial protein involved in the regulation of extracellular matrix remodeling and cell migration through its role in the plasminogen activation system. It binds to urokinase-type plasminogen activator (uPA), facilitating the conversion of plasminogen to plasmin, an essential enzyme for the degradation of fibrin and other components of the extracellular matrix. This function is particularly significant in physiological processes such as wound healing, tissue repair, and embryogenesis. However, aberrant expression or activity of Plaur has been implicated in various pathological conditions, including cancer metastasis, acute and chronic inflammatory diseases, and cardiovascular disorders. Consequently, the study of recombinant Plaur protein has gained significant attention as researchers aim to elucidate its molecular mechanisms, potential therapeutic targets, and broader implications in health and disease. By producing recombinant Plaur, scientists can investigate its structural properties, binding interactions, and functional roles in various biological contexts. Moreover, understanding its interactions with other proteins and pathways may lead to novel interventions for diseases characterized by dysregulated extracellular matrix dynamics. The ongoing research in this field holds the promise of providing insights into better diagnostic and therapeutic strategies that target this multifaceted protein.
