Cat: PA1000-989DB

Recombinant Human EIF1AY Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF1AY

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EIF1AY;Eukaryotic translation initiation factor 1A. Y-chromosomal

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14602

  • Expression Region

    1-144aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELV FKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDD EIQFDDIGDDDEDIDDI

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF1AY, or Eukaryotic Translation Initiation Factor 1A Y-Linked, is a critical protein that plays a pivotal role in the initiation of protein synthesis by facilitating the binding of the ribosome to the mRNA. Research into EIF1AY has gained prominence due to its unique location on the Y chromosome and its potential implications in spermatogenesis and male fertility. Studies have indicated that EIF1AY is highly expressed in testicular tissues, suggesting its essential role in the development of spermatozoa. Additionally, recent investigations have linked mutations or dysregulation of EIF1AY with various male reproductive disorders, including infertility. As a result, recombinant EIF1AY protein has become a focal point for understanding its functional mechanisms and therapeutic potential. Researchers are employing recombinant DNA technology to produce EIF1AY protein for detailed biochemical studies, enabling exploration of its interactions with other translation initiation factors and its impact on cellular stress response and translation fidelity. The insights gleaned from these studies may not only enhance our grasp of male reproductive biology but also contribute to the development of innovative strategies for diagnosing and treating male infertility and related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US