Analytical Data
-
Gene name
EIF1AY
- Application
-
Alternative Names
EIF1AY;Eukaryotic translation initiation factor 1A. Y-chromosomal
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14602
-
Expression Region
1-144aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELV FKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDD EIQFDDIGDDDEDIDDI
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF1AY, or Eukaryotic Translation Initiation Factor 1A Y-Linked, is a critical protein that plays a pivotal role in the initiation of protein synthesis by facilitating the binding of the ribosome to the mRNA. Research into EIF1AY has gained prominence due to its unique location on the Y chromosome and its potential implications in spermatogenesis and male fertility. Studies have indicated that EIF1AY is highly expressed in testicular tissues, suggesting its essential role in the development of spermatozoa. Additionally, recent investigations have linked mutations or dysregulation of EIF1AY with various male reproductive disorders, including infertility. As a result, recombinant EIF1AY protein has become a focal point for understanding its functional mechanisms and therapeutic potential. Researchers are employing recombinant DNA technology to produce EIF1AY protein for detailed biochemical studies, enabling exploration of its interactions with other translation initiation factors and its impact on cellular stress response and translation fidelity. The insights gleaned from these studies may not only enhance our grasp of male reproductive biology but also contribute to the development of innovative strategies for diagnosing and treating male infertility and related conditions.
