Cat: PA1000-990DB

Recombinant Human EIF1B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF1B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EIF1B;Eukaryotic translation initiation factor 1b

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60739

  • Expression Region

    1-113aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDY IHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYG EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF1B, or eukaryotic translation initiation factor 1B, plays a pivotal role in the initiation phase of translation, acting as a key component that facilitates the binding of the ribosome to the mRNA. Recent studies have highlighted its significance in various biological processes, including cell proliferation, differentiation, and stress response. Aberrations in EIF1B expression and function have been implicated in several cancers, suggesting its potential as a therapeutic target. To further investigate the molecular mechanisms of EIF1B and its interactions within the translational machinery, researchers are increasingly focusing on the production of recombinant EIF1B protein. This enables detailed structural and functional analyses, paving the way for a better understanding of its role in translation and its contribution to disease pathology. Furthermore, the ability to produce large quantities of pure EIF1B protein allows for the exploration of its biochemical properties, interaction with other translation factors, and the development of EIF1B-targeted therapies. Thus, the study of recombinant EIF1B not only enhances our comprehension of fundamental cellular processes but also offers promising avenues for clinical applications in oncology and other fields.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US