Analytical Data
-
Gene name
G6PC
- Application
-
Alternative Names
G6PC；G6PC；G6PT；Glucose-6-phosphatase catalytic subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35575
-
Expression Region
82-117aa
-
AA Sequence
QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS
-
Molecular Weight
17.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
G6PC, or glucose-6-phosphatase catalytic subunit, plays a crucial role in glucose homeostasis by facilitating the hydrolysis of glucose-6-phosphate to glucose and inorganic phosphate, a key step in gluconeogenesis and glycogenolysis. Its activity is predominantly found in the liver and kidneys, where it regulates blood sugar levels, making it essential for metabolic processes. Mutations in the G6PC gene can lead to various glycogen storage disorders, most notably Glycogen Storage Disease Type I (GSD-I), which is characterized by severe hypoglycemia, growth retardation, and hepatic complications. Given its significance in metabolic regulation and pathophysiology, research on G6PC recombinant proteins has gained traction. These studies aim to understand the structure-function relationship of G6PC, elucidate the molecular mechanisms underlying GSD-I, and explore therapeutic avenues. By generating recombinant G6PC proteins, scientists analyze enzyme kinetics, investigate potential small-molecule inhibitors, and establish models for drug testing. Additionally, understanding the detailed biochemical pathways involving G6PC can offer insights into broader metabolic disorders and pave the way for novel treatments, potentially improving the quality of life for patients with metabolic diseases. Thus, research on G6PC recombinant proteins is pivotal not only for basic biology but also for translational medicine, highlighting its potential impact on therapeutic strategies and understanding metabolic syndromes.
