Analytical Data
-
Gene name
DCUN1D1
- Application
-
Alternative Names
DCUN1D1；DCN1；DCUN1L1；RP42;DCN1-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GG9
-
Expression Region
1-259aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCL SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK IGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG CDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNY DEEGAWPVLIDDFVEFARPQIAGTKSTTV
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCUN1D1 is a critical protein involved in the regulation of the ubiquitin-proteasome system, which is essential for maintaining cellular homeostasis by controlling protein degradation and turnover. Research into DCUN1D1 has gained significant attention due to its role in various cellular processes, including cell cycle regulation, DNA repair, and response to stress. Mutations or dysregulation of DCUN1D1 have been implicated in several diseases, such as cancer and neurological disorders, highlighting its potential as a biomarker and therapeutic target. Additionally, the protein is integral to the development of the DCUN1D1 complex, which is involved in the transfer of ubiquitin to substrates, thereby influencing protein stability and function. Understanding the structural and functional properties of DCUN1D1 through recombinant protein studies would provide insights into its mechanisms of action and its broader implications in disease pathology. As such, the development of DCUN1D1 recombinant protein for further analysis is crucial for elucidating its role in health and disease, opening avenues for novel treatment strategies and enhancing our understanding of the ubiquitin-mediated signaling pathways in the cell.
