Cat: PA1000-845DB

Recombinant Human DCUN1D1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DCUN1D1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DCUN1D1;DCN1;DCUN1L1;RP42;DCN1-like Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96GG9

  • Expression Region

    1-259aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCL SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK IGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG CDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNY DEEGAWPVLIDDFVEFARPQIAGTKSTTV

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DCUN1D1 is a critical protein involved in the regulation of the ubiquitin-proteasome system, which is essential for maintaining cellular homeostasis by controlling protein degradation and turnover. Research into DCUN1D1 has gained significant attention due to its role in various cellular processes, including cell cycle regulation, DNA repair, and response to stress. Mutations or dysregulation of DCUN1D1 have been implicated in several diseases, such as cancer and neurological disorders, highlighting its potential as a biomarker and therapeutic target. Additionally, the protein is integral to the development of the DCUN1D1 complex, which is involved in the transfer of ubiquitin to substrates, thereby influencing protein stability and function. Understanding the structural and functional properties of DCUN1D1 through recombinant protein studies would provide insights into its mechanisms of action and its broader implications in disease pathology. As such, the development of DCUN1D1 recombinant protein for further analysis is crucial for elucidating its role in health and disease, opening avenues for novel treatment strategies and enhancing our understanding of the ubiquitin-mediated signaling pathways in the cell.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US