Analytical Data
-
Gene name
WDR1
- Application
-
Alternative Names
WDR1；WD repeat-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75083
-
Expression Region
189-461aa
-
AA Sequence
SRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVA
-
Molecular Weight
56.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR1 (WD repeat domain 1) is a highly conserved protein that plays a crucial role in cellular processes such as cytoskeleton dynamics, cell migration, and proliferation. It is known to interact with actin-related proteins and is involved in the regulation of protein complexes that control the actin cytoskeleton, which is essential for numerous cellular functions. Dysregulation of WDR1 has been implicated in various pathological conditions, including cancer metastasis and neurodegenerative diseases, making it a potential therapeutic target. The structural features of WDR1, including its WD repeats, suggest a regulatory role in protein-protein interactions and signaling pathways. Research has focused on understanding the mechanisms by which WDR1 influences actin filament turnover and cellular architecture. Additionally, studies employing recombinant WDR1 protein are crucial for elucidating its biochemical properties and understanding its functional roles in different cellular contexts. By generating and analyzing recombinant WDR1, researchers aim to explore its interactions with other proteins and determine how it contributes to the maintenance of cellular homeostasis. This knowledge is vital for developing novel strategies to modulate WDR1 activity in disease contexts, providing insights into potential therapeutic interventions for conditions linked to aberrant cell behavior.
