Analytical Data
-
Gene name
DCTPP1
- Application
-
Alternative Names
DCTPP1；XTP3TPA;dCTP pyrophosphatase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H773
-
Expression Region
1-170aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMSVAGGEIRGDTGGEDTAAPGRFSFS PEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTD GEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINR RRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCTPP1, or dCTP pyrophosphatase 1, is an essential enzyme involved in nucleotide metabolism, playing a crucial role in the regulation of cellular dCTP levels. Dysregulation of dCTP pools can significantly impact DNA synthesis and repair mechanisms, making DCTPP1 a key player in maintaining genomic stability. Recent studies have suggested that DCTPP1 may also be implicated in various diseases, including cancer, where altered nucleotide metabolism can promote tumorigenesis. Understanding the structure and function of DCTPP1 is vital for elucidating its biochemical pathways and potential therapeutic targets. Recombinant DCTPP1 proteins have become increasingly important in these studies, enabling researchers to explore enzyme kinetics, inhibition, and interaction with other cellular components. Moreover, the production of recombinant DCTPP1 facilitates high-throughput screening of small molecules that could serve as inhibitors or modulators of its activity, which may have therapeutic implications. As research continues to uncover the multifaceted roles of DCTPP1, the recombinant protein serves as a fundamental tool in advancing our understanding of nucleotide metabolism and its impact on cellular health and disease.
