Analytical Data
-
Gene name
DRAP1
- Application
-
Alternative Names
DRAP1；Dr1-associated corepressor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14919
-
Expression Region
4-198aa
-
AA Sequence
KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
-
Molecular Weight
48.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DRAP1, or Death Receptor Apoptosis-Inducing Protein 1, is a crucial player in the regulation of apoptosis and cell survival. It has garnered attention in recent years due to its potential role in various diseases, including cancer and neurodegenerative disorders. Research indicates that DRAP1 interacts with death receptors and modulates apoptotic signaling pathways, influencing cell fate decisions. As cancer therapies increasingly target apoptotic pathways, understanding the function and mechanism of DRAP1 becomes vital for developing novel treatment strategies. Additionally, studies have suggested that DRAP1 may contribute to the cellular response to stress and inflammatory signals, further highlighting its importance in maintaining homeostasis. The recombinant production of DRAP1 protein facilitates in-depth studies on its structure, function, and interactions, paving the way for therapeutic applications. Investigating DRAP1's role in disease mechanisms could lead to breakthroughs in understanding tumorigenesis and neurodegeneration, making it a promising target for future research and drug development.
