Analytical Data
-
Gene name
SLC30A6
- Application
-
Alternative Names
SLC30A6；ZNT6；Zinc transporter 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NXT4
-
Expression Region
1-461aa
-
AA Sequence
MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFDLFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
-
Molecular Weight
51.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC30A6, a member of the SLC30 family of zinc transporters, plays a crucial role in zinc homeostasis within cells. Research on SLC30A6 is motivated by the importance of zinc as an essential trace element involved in numerous biological processes, including enzyme function, cellular signaling, and transcriptional regulation. Dysregulation of zinc transport can lead to various health issues, such as neurodegenerative disorders, immune dysfunction, and cancer. The recombinant protein of SLC30A6 has garnered attention due to its potential therapeutic implications, as understanding its structure and function can provide insights into zinc transport mechanisms and their physiological relevance. Moreover, the study of SLC30A6 may unveil novel pathways for drug development targeting zinc-related pathologies. Utilizing recombinant DNA technology, scientists can produce SLC30A6 in host systems, allowing for detailed biochemical and biophysical characterization of the protein. This includes studying the transporter’s kinetic properties, substrate specificity, and interactions with other cellular components. Furthermore, examining the expression patterns and functional consequences of SLC30A6 mutations can enhance our understanding of its role in health and disease. Overall, research on SLC30A6 recombinant protein holds promise for unraveling the complexities of zinc metabolism and its impact on human health, paving the way for innovative therapeutic approaches.
