Cat: PA1000-737DB

Recombinant Human CSF2RA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSF2RA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSF2RA;CSF2R;CSF2RY;Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15509

  • Expression Region

    20-320aa

  • AA Sequence

    ADPLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKK NRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGR EGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCP YYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIE RFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGT ENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFG SDDGHHHHHH

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha) is a critical receptor that modulates the immune response by binding to the granulocyte-macrophage colony-stimulating factor (GM-CSF), a cytokine involved in hematopoiesis and immune regulation. Research into CSF2RA and its recombinant proteins has gained significant attention due to their potential therapeutic applications in treating various diseases, including autoimmune disorders, inflammatory diseases, and certain cancers. The role of GM-CSF in promoting the differentiation and activation of myeloid cells highlights the importance of CSF2RA in immune responses and tissue homeostasis. Recombinant CSF2RA proteins are being studied for their ability to enhance immune responses, particularly in immunotherapy settings, where they may facilitate the anti-tumor activity of immune cells. Moreover, understanding the structure-function relationships of CSF2RA is crucial for developing potent inhibitors or agonists that could serve as therapeutic agents. Overall, the exploration of CSF2RA recombinant proteins offers promising avenues for improving immune-related therapies, with the potential to provide novel strategies for managing a variety of immune-mediated conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US