Analytical Data
-
Gene name
CCND2
- Application
-
Alternative Names
CCND2；G1/S-specific cyclin-D2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30279
-
Expression Region
1-289aa
-
AA Sequence
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
-
Molecular Weight
80.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cyclin D2 (CCND2) is a crucial regulatory protein that plays a significant role in cell cycle progression, particularly in the transition from the G1 phase to the S phase. As part of the cyclin family, CCND2 pairs with cyclin-dependent kinases (CDKs) to drive the progression of cells through various phases of the cell cycle. Abnormal expression or mutations in CCND2 have been implicated in several malignancies, making it a target of interest in cancer research. Studies have shown that CCND2 contributes not only to cell proliferation but also to the regulation of apoptosis and differentiation processes. Its overexpression is frequently observed in various cancers, including breast, prostate, and multiple myeloma. Consequently, understanding the structure and function of CCND2, especially through the study of recombinant protein, can provide insights into its mechanistic role in oncogenesis and may reveal potential therapeutic targets for cancer treatment. Research involving the recombinant expression of CCND2 allows scientists to explore its biochemical properties, interactions with CDKs, and its influence on downstream signaling pathways. This knowledge is critical for developing targeted interventions that could inhibit its oncogenic effects, ultimately contributing to improved strategies for cancer therapy.
