Cat: PA1000-9222

Recombinant Human ROR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ROR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ROR2;NTRKR2;Tyrosine-Protein kinase transmembrane receptor ROR2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01974

  • Expression Region

    34-403aa

  • AA Sequence

    EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHC KVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYY QCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACA RFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCH FVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQL PKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKS GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKN VRMELCDVPSCSPRDSSKMG

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ROR2, a member of the receptor tyrosine kinase-like orphan receptor family, plays a crucial role in various physiological and pathological processes, including skeletal development and tumor progression. It is predominantly expressed in skeletal tissues and is essential for proper limb formation during embryonic development. Mutations in the ROR2 gene are linked to bone disorders such as Robinow syndrome, characterized by skeletal dysplasia and other developmental abnormalities. Additionally, ROR2 has been implicated in cancer biology, where its expression levels can influence tumor growth and metastasis. Research on the recombinant protein of ROR2 has gained momentum due to its potential as a therapeutic target. By generating ROR2 recombinant proteins, scientists aim to elucidate its biological functions and signaling pathways, which could lead to innovative treatments for diseases associated with ROR2 dysregulation. Understanding the structure-function relationship of ROR2 at the protein level can also facilitate the design of novel inhibitors or modulators that could intervene in its signaling mechanisms. Thus, the study of ROR2 recombinant protein is pivotal not only for basic research but also for developing strategies to combat ROR2-related disorders and malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US