Analytical Data
-
Gene name
CCNB
- Application
-
Alternative Names
CCNB；CCNB；G2/mitotic-specific cyclin-B1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14635
-
Expression Region
1-433aa
-
AA Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
-
Molecular Weight
50.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCNB, or Cyclin B, is a crucial protein involved in the regulation of the cell cycle, particularly during the transition from the G2 phase to mitosis. In recent years, extensive research has focused on the role of CCNB and its associated cyclin-dependent kinases (CDKs) in various biological processes, including cell proliferation, apoptosis, and tumorigenesis. The dysregulation of CCNB expression and function has been implicated in several types of cancer, making it a potential target for therapeutic interventions. Understanding the molecular mechanisms underlying CCNB activity and its interactions with other cell cycle regulators is essential for elucidating the pathways that contribute to cancer development. In this context, the recombinant expression of CCNB has emerged as a valuable tool for investigating its functional properties, enabling researchers to produce large quantities of the protein for biochemical assays, structural studies, and drug screening. By utilizing advanced recombinant DNA technology, scientists can generate CCNB variants to dissect its roles in cell cycle regulation and explore its potential as a biomarker or target for cancer therapy. Overall, the study of CCNB and its recombinant forms contributes to a deeper understanding of cell cycle control and opens new avenues for the development of cancer treatments.
