Analytical Data
-
Gene name
RAMP2
- Application
-
Alternative Names
RAMP2；Receptor activity-modifying Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60895
-
Expression Region
43-175aa
-
AA Sequence
QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAMP2 (Receptor Activity-Modifying Protein 2) is a member of the RAMP family, which plays a crucial role in modulating the activity of G protein-coupled receptors (GPCRs), particularly the calcitonin gene-related peptide (CGRP) receptor. This protein has garnered significant interest due to its involvement in various physiological processes, including pain sensation, cardiovascular regulation, and metabolic functions. Research indicates that RAMP2 influences receptor trafficking, signaling, and ligand binding, thereby affecting the potency and efficacy of CGRP and related peptides. Dysregulation of RAMP2 has been implicated in several pathological conditions, such as migraines, cardiovascular diseases, and metabolic disorders. Over the past few years, the study of RAMP2 has expanded, focusing on its potential as a therapeutic target. Understanding the structure and function of RAMP2, including its interactions with different ligands and receptors, is essential for the development of new pharmacological agents that could modulate CGRP signaling pathways. Furthermore, recombinant RAMP2 protein production offers valuable opportunities for functional assays and structural studies, facilitating the exploration of its role in disease mechanisms and the design of novel treatments. As research progresses, RAMP2 continues to represent a promising area of investigation within the broader context of GPCR biology and therapeutic innovation.
