Cat: PA1000-468DB

Recombinant Human CCM2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCM2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCM2;C7orf22;Cerebral cavernous malformations 2 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BSQ5-3

  • Expression Region

    66-353aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEVKYLGQLTSIPGYLNPSSRTEILHFI DNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAV SYVRDDAAHLVVLKTDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHS KTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHE FCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITD SFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDIE ALGCSMDQDSA

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCM2, or cerebral cavernous malformation 2, is a protein linked to the formation of cerebral cavernous malformations, which are vascular lesions in the brain that can lead to seizures, hemorrhage, or neurological deficits. Mutations in the CCM2 gene are known to be associated with familial and sporadic cases of these malformations. Research on CCM2 recombinant proteins has gained traction due to their potential role in elucidating the molecular mechanisms underlying the development and progression of cavernous malformations. Understanding the functional properties of CCM2 and its interactions with other cellular components is critical, as it may reveal therapeutic targets for the treatment of these conditions. Furthermore, studies involving CCM2 can provide insights into vascular development and maintenance, highlighting its significance in broader contexts such as angiogenesis and endothelial cell biology. This research area has the potential to advance our knowledge of CCM pathophysiology and inform the development of novel strategies for prevention and management of cerebrovascular diseases associated with CCM2 mutations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US