Analytical Data
-
Gene name
CCL4L1
- Application
-
Alternative Names
CCL4L1；CCL4L；LAG1；SCYA4L1；C-C motif chemokine 4-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHW4
-
Expression Region
24 -92aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFV VDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL4L1, a member of the C-C motif chemokine family, plays a crucial role in immune responses and inflammatory processes. It is primarily involved in recruiting monocytes and lymphocytes to sites of inflammation, thus contributing to the pathogenesis of various diseases, including autoimmune disorders and infections. Research has highlighted its significance in conditions like HIV infection, where it can influence viral replication and persistence. Additionally, CCL4L1 and its receptors exhibit potential therapeutic targets for modulating immune responses, making them intriguing for drug development. Studies have focused on the recombinant expression of CCL4L1 to facilitate the exploration of its functional properties and its interaction with immune cells. Understanding the structure-function relationship of CCL4L1 at the molecular level could pave the way for innovative treatments targeting immune dysregulation. Expanding our knowledge of CCL4L1 may offer insights into more effective therapeutic strategies for various immune-related diseases, emphasizing the importance of continued research in this area.
