Analytical Data
-
Gene name
PLN
- Application
-
Alternative Names
PLN;PLB;Cardiac phospholamban
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26678
-
Expression Region
1-30aa
-
AA Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQN
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLN (phospholamban) is a key regulator of cardiac muscle contraction, playing a crucial role in calcium cycling and heart function. It predominantly resides in the sarcoplasmic reticulum of cardiac myocytes, where it inhibits the calcium ATPase (SERCA2a), thereby affecting intracellular calcium levels essential for muscle contraction and relaxation. Research into PLN and its associated pathways has garnered significant attention due to its implications in heart diseases, particularly heart failure. Abnormalities in PLN expression or function can lead to compromised cardiac performance, making it a potential therapeutic target. Recent advancements in recombinant protein technology have facilitated the production of PLN variants, allowing researchers to dissect its structural and functional properties with greater precision. Investigating these recombinant PLN proteins aids in understanding their role in health and disease, potentially leading to novel treatments for cardiac dysfunction. Through such studies, scientists aim to uncover the molecular mechanisms underlying PLN regulation, paving the way for innovative approaches to enhance cardiac function and develop targeted therapies for cardiovascular diseases.











