Analytical Data
-
Gene name
RB1
- Application
-
Alternative Names
RB1;Retinoblastoma-associated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06400
-
Expression Region
769-921aa
-
AA Sequence
LQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMD
-
Molecular Weight
24.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RB1, the gene encoding the retinoblastoma protein, plays a crucial role in cell cycle regulation and tumor suppression. Mutations in RB1 are famously linked to retinoblastoma, a pediatric eye cancer, but the implications of RB1 dysregulation extend to various other cancers as well. Research on the RB1 recombinant protein focuses on its structure and function, providing insights into the molecular mechanisms underlying tumorigenesis. Studies have demonstrated that the retinoblastoma protein interacts with a network of other proteins to control the transition from the G1 to S phase of the cell cycle, effectively preventing excessive cell proliferation. Recombining RB1 protein in laboratory settings allows scientists to investigate its interactions, regulatory pathways, and potential as a therapeutic target. Furthermore, advancements in biotechnology enable the production of large quantities of RB1 recombinant protein, facilitating its use in drug development and cancer research. Understanding its role can elucidate cancer pathways, leading to innovative treatment strategies that might resurrect the functional activity of the retinoblastoma pathway in malignancies where it is compromised. Thus, the study of RB1 recombinant protein is not only critical for comprehending the fundamental biology of cancer but also holds the potential for developing therapeutic interventions that could restore normal cell cycle regulation in cancer patients.











