Analytical Data
-
Gene name
CCL22
- Application
-
Alternative Names
CCL22；MDC；SCYA22；C-C motif chemokine 22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00626
-
Expression Region
25-93aa
-
AA Sequence
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL22, also known as macrophage-derived chemokine (MDC), is a member of the CC chemokine family that plays a vital role in immune response regulation. It is primarily involved in the recruitment of specific immune cells, particularly T-helper 2 (Th2) cells and regulatory T cells (Tregs), to sites of inflammation and tumors. Research has shown that CCL22 is overexpressed in various cancer types, contributing to tumor evasion of the immune system by promoting Treg migration, thus limiting anti-tumor immune responses. Additionally, CCL22 has been implicated in chronic inflammatory conditions and allergic responses. Understanding the biological functions of CCL22 and its signaling mechanisms offers potential therapeutic avenues for enhancing anti-tumor immunity and modulating inflammatory diseases. The production of recombinant CCL22 protein facilitates further study into its biochemical properties, receptor interactions, and role in immune cell migration and activation. This research could ultimately inform the design of novel immunotherapies or targeted treatments aimed at manipulating CCL22 levels to influence immune responses favorably. As such, the study of recombinant CCL22 holds significant promise for advancing our understanding of immune regulation and developing innovative approaches to cancer and inflammatory diseases.
