Analytical Data
-
Gene name
CCL21
- Application
-
Alternative Names
CCL21；SCYA21；C-C motif chemokine 21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00585
-
Expression Region
24-13aa
-
AA Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL21, also known as chemokine (C-C motif) ligand 21, is a critical cytokine involved in immune system regulation and lymphocyte trafficking. It is predominantly expressed in secondary lymphoid organs like lymph nodes and the spleen, where it plays a pivotal role in guiding dendritic cells and naïve T cells to their sites of activation. The study of recombinant CCL21 proteins has gained prominence due to their potential applications in immunotherapy and vaccine development. Understanding the structure and function of CCL21 can aid in elucidating its involvement in various physiological and pathological processes, including autoimmune diseases, cancer progression, and viral infections. Researchers are increasingly interested in the recombinant expression of CCL21 to create therapeutics that can enhance immune responses or inhibit tumor growth by harnessing the body's natural defense mechanisms. Moreover, the ability to produce CCL21 in a controlled laboratory setting allows for in-depth studies of its interactions with receptors and other immune mediators. Overall, the research on recombinant CCL21 proteins holds significant promise for advancing our understanding of immune regulation and developing innovative therapeutic strategies.
