Analytical Data
-
Gene name
RBP3
- Application
-
Alternative Names
RBP3;Ran-binding Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10745
-
Expression Region
1149-1246aa
-
AA Sequence
GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSV GASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBP3, also known as Retinol Binding Protein 3, is a member of the lipocalin protein family that plays a crucial role in the transport of retinoids, particularly in the visual cycle and various biochemical processes related to vision. Understanding the structure and function of RBP3 is essential for insights into retinoid metabolism and associated disorders, such as retinitis pigmentosa and age-related macular degeneration. Research on recombinant RBP3 protein has gained traction as it allows for detailed studies of its biochemical properties, interactions, and potential therapeutic applications. The production of recombinant RBP3 provides a controlled environment to explore its binding affinities to retinoids and assess its role in retinal health and disease mechanisms. Furthermore, recombinant RBP3 can be used in drug delivery systems or as a biomarker for ocular diseases, making it a significant focus in molecular and cellular biology. With advancements in recombinant DNA technology, researchers aim to enhance the yield and functionality of RBP3, facilitating further studies on its therapeutic potential and paving the way for novel intervention strategies in retinal diseases.











