Cat: PA1000-9213

Recombinant Human RBP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RBP3;Ran-binding Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10745

  • Expression Region

    1149-1246aa

  • AA Sequence

    GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSV GASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RBP3, also known as Retinol Binding Protein 3, is a member of the lipocalin protein family that plays a crucial role in the transport of retinoids, particularly in the visual cycle and various biochemical processes related to vision. Understanding the structure and function of RBP3 is essential for insights into retinoid metabolism and associated disorders, such as retinitis pigmentosa and age-related macular degeneration. Research on recombinant RBP3 protein has gained traction as it allows for detailed studies of its biochemical properties, interactions, and potential therapeutic applications. The production of recombinant RBP3 provides a controlled environment to explore its binding affinities to retinoids and assess its role in retinal health and disease mechanisms. Furthermore, recombinant RBP3 can be used in drug delivery systems or as a biomarker for ocular diseases, making it a significant focus in molecular and cellular biology. With advancements in recombinant DNA technology, researchers aim to enhance the yield and functionality of RBP3, facilitating further studies on its therapeutic potential and paving the way for novel intervention strategies in retinal diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US