Analytical Data
-
Gene name
GLMP
- Application
-
Alternative Names
GLMP；C1orf85；Glycosylated lysosomal membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWB7
-
Expression Region
1-406aa
-
AA Sequence
MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLLHTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFAQWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYLSWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLMP (Glutamine Triggered Lipid Metabolism Protein) is a crucial protein involved in regulating lipid metabolism, particularly in the context of energy homeostasis and cellular signaling. Research on GLMP has gained momentum due to its potential implications in metabolic disorders, including obesity and diabetes. Originally identified in studies of lipid metabolism, GLMP appears to interact with various key metabolic pathways, modulating factors such as insulin sensitivity and lipid storage. Moreover, its regulatory functions have raised interest in understanding how GLMP might serve as a therapeutic target for treating metabolic diseases. The complexity of GLMP’s role in cellular processes necessitates a detailed exploration of its structure, function, and interactions at the molecular level. Recent advances in recombinant protein technology have facilitated the production and characterization of GLMP, allowing researchers to study its biological functions in greater depth. By employing techniques such as protein engineering, crystallography, and mutagenesis, scientists aim to uncover the mechanistic details of GLMP’s involvement in lipid metabolism. This research is crucial not only for elucidating the biological significance of GLMP itself but also for developing novel strategies aimed at combating metabolic diseases linked to dysregulated lipid metabolism. As the global prevalence of such conditions rises, understanding proteins like GLMP becomes increasingly important in the quest for effective therapies and interventions.
