Analytical Data
-
Gene name
CCL19
- Application
-
Alternative Names
CCL19；ELC；MIP3B；SCYA19；C-C motif chemokine 19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99731
-
Expression Region
22-98aa
-
AA Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
-
Molecular Weight
35.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL19, also known as chemokine (C-C motif) ligand 19, is a crucial member of the chemokine family that plays a significant role in immune system regulation, particularly in lymphocyte migration and tissue homing. It primarily acts by binding to its receptor, CCR7, which is essential for the trafficking of T cells and dendritic cells to lymphoid organs and inflammatory sites. Due to its pivotal role in immune responses, CCL19 has garnered attention in various fields, including immunology, oncology, and infectious diseases. In cancer research, manipulating CCL19 signaling pathways is being explored as a strategy for enhancing anti-tumor immunity and developing novel immunotherapies. Moreover, the recombinant production of CCL19 protein has facilitated its study in vitro and in vivo, allowing researchers to better understand its biological functions, receptor interactions, and potential therapeutic applications. By examining the effects of CCL19 on immune cells, scientists aim to elucidate its mechanisms of action, paving the way for innovative treatments for conditions such as cancer, autoimmunity, and chronic inflammation. The ongoing exploration of CCL19 and its recombinant protein forms continues to unveil its complexities, contributing significantly to our understanding of the immune landscape and presenting new avenues for therapeutic interventions.
